PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00104_0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family NF-YA
Protein Properties Length: 298aa    MW: 32519.2 Da    PI: 7.0937
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00104_0100genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.71.4e-31136193158
      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                    +ep+YVNaKQy++Il+RRq Rakle+e++l ++ ++pylheSRh+hAlrR+Rg+gGrF
  kfl00104_0100 136 EEPVYVNAKQYHGILRRRQIRAKLEQENRLVKARKQPYLHESRHQHALRRARGCGGRF 193
                    69****************************9999***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-36134196IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.597135196IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-26137193IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-23138160IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860140160IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.2E-23170193IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSQPSFNPLV SPQSHTPISR PGGHGNNTHA PGVVGEGSLA GVSAPVYMAH PAYEGQAVEE  60
HHPVQPPVPT AAVPHMEHYP GYPHVDMGRV PYHTPYDPYY SATMMGYGHQ PMAPHPLLAA  120
QTARMPLPMS ELLPEEEPVY VNAKQYHGIL RRRQIRAKLE QENRLVKARK QPYLHESRHQ  180
HALRRARGCG GRFLNTKPEK KDEEQGGAAQ EGANSSGATT EAPQNQETGA ASQQNPNNLP  240
EAPSNLQHEE QPALVYSNAV VVPQYMHANG QAGYPMAAYH PHYGPGSEQL PQPGLTSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19136202265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S42_174V6.18e-40(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.11e-29nuclear factor Y, subunit A4